| AgACC | Ag000555 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MAGEC2 |
| Common Name | MAGE-C2 |
| Full Name | Melanoma-associated antigen C2 |
| Synonym | Cancer-testis antigen 10; Hepatocellular carcinoma-associated antigen 587; MAGE-C2 antigen; MAGE-E1 antigen; cancer-testis antigen CT10; hepatocellular cancer antigen 587; melanoma antigen family C, 2; melanoma antigen, family E, 1 protein; melanoma antigen, family E, 1, cancer/testis specific; melanoma-associated antigen E1
another display format
- Cancer-testis antigen 10
- Hepatocellular carcinoma-associated antigen 587
- MAGE-C2 antigen
- MAGE-E1 antigen
- cancer-testis antigen CT10
- hepatocellular cancer antigen 587
- melanoma antigen family C, 2
- melanoma antigen, family E, 1 protein
- melanoma antigen, family E, 1, cancer/testis specific
- melanoma-associated antigen E1
|
| UniProt ID | Q9UBF1
|
| NCBI Gene ID | 51438 |
| GeneCard ID | GC0XM142202 |
| COSMIC ID | 25494
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000036, Ag001757
Alignment of all Isoforms |
| Mutation entries | Ag000555
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASS |
| Antigen sequence | MPPVPCVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASS |