| AgACC | Ag000549 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ITPR2 |
| Full Name | Inositol 1,4,5-triphosphate receptor, type 2 |
| Synonym | IP3R2; InsP3R2; IP3 receptor isoform 2; Inositol 1,4,5-trisphosphate receptor type 2; Type 2 InsP3 receptor; Type 2 inositol 1,4,5- trisphosphate receptor; inositol 1,4,5-triphosphate receptor, type 2
another display format
- IP3R2
- InsP3R2
- IP3 receptor isoform 2
- Inositol 1,4,5-trisphosphate receptor type 2
- Type 2 InsP3 receptor
- Type 2 inositol 1,4,5- trisphosphate receptor
- inositol 1,4,5-triphosphate receptor, type 2
|
| UniProt ID | Q14571
|
| NCBI Gene ID | 3709 |
| GeneCard ID | GC12M026336 |
| COSMIC ID | 22742
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000459, Ag000460
Alignment of all Isoforms |
| Mutation entries | Ag000548, Ag000549, Ag000550, Ag000551, Ag000552
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | EGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV |
| Antigen sequence | EGTKADLEVLTYYRYQLNLFSRMCLDRQYLAINQISTQLSV |
|