| AgACC | Ag000404 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | BCL-2 |
| Common Name | Bcl-2 |
| Full Name | Apoptosis regulator Bcl-2 |
| Synonym | B-cell CLL/lymphoma 2; B-cell lymphoma protein 2
another display format
- B-cell CLL/lymphoma 2
- B-cell lymphoma protein 2
|
| UniProt ID | P10415
|
| NCBI Gene ID | 596 |
| GeneCard ID | GC18M063123 |
| Comment | This is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000405, Ag002051
Alignment of all Isoforms |
| Mutation entries | Ag004048, Ag004049, Ag004050, Ag004051
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| ALSPVPPVV | 85-93 | A*0201 |
17182178 |
| NIALWMTEYL | 172-181 | A2 |
15367432 |
| PLFDFSWLSL | 208-217 | A2 |
15367432 |
| WLSLKTLLSL | 214-223 | A2 |
15367432 |
| YLNRHLHTWI | 180-189 | A2 |
15367432 |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference |
| AAAGPALSPV | 80-89 | A2 |
15367432 |
| ALVGACITL | 224-232 | A2 |
15367432 |
| FTARGRFATV | 124-133 | A2 |
15367432 |
| KTLLSLALV | 218-226 | A2 |
15367432 |
| SLALVGACI | 222-230 | A2 |
15367432 |
| Predicted HLA binders | |
| Antigen sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS
PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF
DFSWLSLKTLLSLALVGACITLGAYLGHK |