| AgACC | Ag000257 |
| Date | 11-02-2007 |
| Last updated | 10-10-2019 |
| Antigen Name | NFYC |
| Full Name | Nuclear transcription factor Y subunit C |
| Synonym | CAAT-box DNA-binding protein subunit C; CCAAT binding factor subunit C; CCAAT transcription binding factor subunit gamma; CCAAT-binding factor, C subunit; Nuclear transcription factor Y subunit gamma; Transactivator HSM-1/2; histone H1 transcription factor large subunit 2A; homologous to rat CCAAT binding factor subunit C (rCBF-C); nuclear transcription factor Y; gamma, transactivator HSM-1; transcription factor NF-Y; C subunit CBF-C; CBFC; DKFZp667G242; FLJ45775; H1TF2A; HAP5; HSM; NF-Y; hCBF-C; NFYC
another display format
- CAAT-box DNA-binding protein subunit C
- CCAAT binding factor subunit C
- CCAAT transcription binding factor subunit gamma
- CCAAT-binding factor, C subunit
- Nuclear transcription factor Y subunit gamma
- Transactivator HSM-1/2
- histone H1 transcription factor large subunit 2A
- homologous to rat CCAAT binding factor subunit C (rCBF-C)
- nuclear transcription factor Y
- gamma, transactivator HSM-1
- transcription factor NF-Y
- C subunit CBF-C
- CBFC
- DKFZp667G242
- FLJ45775
- H1TF2A
- HAP5
- HSM
- NF-Y
- hCBF-C
- NFYC
|
| UniProt ID | Q13952
|
| NCBI Gene ID | 4802 |
| GeneCard ID | GC01P040691 |
| Comment | This is a putative sequence. |
| Annotation | This is a fragment sequence. |
| Mutation entries | Ag000257, Ag000556
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| QQITKTEV | 14-21 | B52 |
16287085 |
| Predicted HLA binders | |
| Reference sequence | ASQGKPRRCLKETLQITQTEVQQGQQQFSQFTDGQRNSVQQ |
| Antigen sequence | ASQGKPRRCLKETQQITKTEVQQGQQQFSQFTDGQRNSVQQ |