| AgACC | Ag000184 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | RAGE |
| Full Name | Renal tumor antigen 1 |
| Synonym | Human renal cell carcinoma antigen RAGE-2 mRNA; complete putative cds; LE-9211-A antigen; MAPK/MAK/MRK overlapping kinase; MOK protein kinase; antigen recognized by autologous cytolytic T lymphocytes; renal cell carcinoma antigen (MOK protein kinase); renal tumor antigen; EC 2.7.11.22; MOK; RAGE-1; RAGE
another display format
- Human renal cell carcinoma antigen RAGE-2 mRNA
- complete putative cds
- LE-9211-A antigen
- MAPK/MAK/MRK overlapping kinase
- MOK protein kinase
- antigen recognized by autologous cytolytic T lymphocytes
- renal cell carcinoma antigen (MOK protein kinase)
- renal tumor antigen
- EC 2.7.11.22
- MOK
- RAGE-1
- RAGE
|
| UniProt ID | Q9UQ07
|
| NCBI Gene ID | 5891 |
| GeneCard ID | GC14M102224 |
| Comment | This is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000182, Ag000183, Ag000185
Alignment of all Isoforms |
| Mutation entries | Ag000560, Ag003573, Ag003574, Ag003575, Ag003576, Ag003577
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| LKLSGVVRL | 6-14 | A2 |
15900605 |
| PASKKTDPQK | 44-53 | B8 |
9865739 |
| Predicted HLA binders | |
| Antigen sequence | MELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRK
GGR |