| AgACC | Ag002138 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | H3F3A |
| Full Name | H3 histone, family 3A |
| Synonym | H3.3A; H3.3B; H3F3; H3F3B; MGC87782; MGC87783; Histone H3.3
another display format
- H3.3A
- H3.3B
- H3F3
- H3F3B
- MGC87782
- MGC87783
- Histone H3.3
|
| UniProt ID | A5PLR1
|
| NCBI Gene ID | 3020 |
| GeneCard ID | GC01P226061 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000514, Ag002135, Ag002136, Ag002140, Ag002141, Ag002142
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| ELLIRKLPF | 60-68 | B8 |
16196104 |
| Predicted HLA binders | |
| Antigen sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |