| AgACC | Ag002122 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | IER3 |
| Common Name | immediate early response gene X-1 (IEX-1) |
| Full Name | Immediate early response 3 |
| Synonym | DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1; PRG1; Differentiation-dependent gene 2 protein; Immediate early protein GLY96; Immediate early response 3 protein; PACAP-responsive gene 1; PACAP-responsive gene 1 protein; Protein DIF-2; Protein PRG1; Radiation-inducible immediate-early gene IEX-1; anti-death protein; differentiation-dependent gene 2; expressed in pancreatic carcinoma; gly96, mouse, homolog of; immediate early response 3; immediately early gene X-1
another display format
- DIF-2
- DIF2
- GLY96
- IEX-1
- IEX-1L
- IEX1
- PRG1
- Differentiation-dependent gene 2 protein
- Immediate early protein GLY96
- Immediate early response 3 protein
- PACAP-responsive gene 1
- PACAP-responsive gene 1 protein
- Protein DIF-2
- Protein PRG1
- Radiation-inducible immediate-early gene IEX-1
- anti-death protein
- differentiation-dependent gene 2
- expressed in pancreatic carcinoma
- gly96, mouse, homolog of
- immediate early response 3
- immediately early gene X-1
|
| UniProt ID | Q53HJ2
|
| NCBI Gene ID | 8870 |
| GeneCard ID | GC06M030743 |
| Comment | This is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000503, Ag002121, Ag002123, Ag002124, Ag002125, Ag002126
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| QLPVEEPNP | 74-82 | A33 |
15087407 |
| RSRRVLYPR | 61-69 | A33 |
15087407 |
| VLYPRVVRR | 65-73 | A33 |
15087407 |
| Predicted HLA binders | |
| Antigen sequence | MCHSRSCHLTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRV
VRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSPVLEPFNLTSEPSD
YALDLSTFLQQHPAAF |