Antigen Record Ag002122

AgACCAg002122
Date04-08-2008
Last updated14-12-2016
Antigen NameIER3
Common Nameimmediate early response gene X-1 (IEX-1)
Full NameImmediate early response 3
SynonymDIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1; PRG1; Differentiation-dependent gene 2 protein; Immediate early protein GLY96; Immediate early response 3 protein; PACAP-responsive gene 1; PACAP-responsive gene 1 protein; Protein DIF-2; Protein PRG1; Radiation-inducible immediate-early gene IEX-1; anti-death protein; differentiation-dependent gene 2; expressed in pancreatic carcinoma; gly96, mouse, homolog of; immediate early response 3; immediately early gene X-1

another display format
  • DIF-2
  • DIF2
  • GLY96
  • IEX-1
  • IEX-1L
  • IEX1
  • PRG1
  • Differentiation-dependent gene 2 protein
  • Immediate early protein GLY96
  • Immediate early response 3 protein
  • PACAP-responsive gene 1
  • PACAP-responsive gene 1 protein
  • Protein DIF-2
  • Protein PRG1
  • Radiation-inducible immediate-early gene IEX-1
  • anti-death protein
  • differentiation-dependent gene 2
  • expressed in pancreatic carcinoma
  • gly96, mouse, homolog of
  • immediate early response 3
  • immediately early gene X-1
UniProt IDQ53HJ2
NCBI Gene ID8870
GeneCard IDGC06M030743
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000503Ag002121Ag002123Ag002124Ag002125Ag002126

Alignment of all Isoforms
RNA/protein expression profileRNA and protein Expression profile
T cell epitopeEpitope sequencePositionHLA alleleReference
QLPVEEPNP74-82 A33  15087407
RSRRVLYPR61-69 A33  15087407
VLYPRVVRR65-73 A33  15087407
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMCHSRSCHLTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRV
VRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSPVLEPFNLTSEPSD
YALDLSTFLQQHPAAF