| AgACC | Ag002018 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | DEK |
| Common Name | DEK oncogene |
| Full Name | DEK oncogene |
| Synonym | DEK gene; DEK oncogene (DNA binding); Protein DEK; D6s231E; OTTHUMP00000039357
another display format
- DEK gene
- DEK oncogene (DNA binding)
- Protein DEK
- D6s231E
- OTTHUMP00000039357
|
| UniProt ID | Q6MZJ9
|
| NCBI Gene ID | 7913 |
| GeneCard ID | GC06M018224 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000347
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference |
| KVYENYPTY | 7-15 | A3 |
9271594 |
| KVYENYPTY | 7-15 | B*1517 |
9029102 |
| Predicted HLA binders | |
| Antigen sequence | MKQICKKVYENYPTYDLTERKDFIKTTVKEVNISVFQV |