| AgACC | Ag001865 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MRPL28 |
| Common Name | Melanoma antigen p15 |
| Full Name | Mitochondrial ribosomal protein L28 |
| Synonym | 39S ribosomal protein L28; mitochondrial precursor; Melanoma antigen p15; Melanoma-associated antigen recognized by T lymphocytes,melanoma-associated antigen recognised by cytotoxic T lymphocytes; L28mt; MAAT1; MGC8499; MRP-L28; MRPL28; p15
another display format
- 39S ribosomal protein L28
- mitochondrial precursor
- Melanoma antigen p15
- Melanoma-associated antigen recognized by T lymphocytes,melanoma-associated antigen recognised by cytotoxic T lymphocytes
- L28mt
- MAAT1
- MGC8499
- MRP-L28
- MRPL28
- p15
|
| UniProt ID | Q6FHK1
|
| NCBI Gene ID | 10573 |
| GeneCard ID | GC16M000357 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000174, Ag001864
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| AYGLDFYIL | 10-18 | A24 |
7751637 |
| Predicted HLA binders | |
| Antigen sequence | MRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPE
EEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIHVAELIQQLQQQALSEPAVVQKTASGQ |