| AgACC | Ag001639 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | RPL10A |
| Common Name | Ribosomal protein L10a |
| Full Name | Ribosomal protein L10a |
| Synonym | 60S ribosomal protein L10a; Neural precursor cell expressed developmentally down-regulated protein 6; Protein NEDD6; neural precursor cell expressed, developmentally down-regulated 6;CSA-19; Csa-19; NEDD-6; NEDD6
another display format
- 60S ribosomal protein L10a
- Neural precursor cell expressed developmentally down-regulated protein 6
- Protein NEDD6
- neural precursor cell expressed, developmentally down-regulated 6
- CSA-19
- Csa-19
- NEDD-6
- NEDD6
|
| UniProt ID | Q1JQ76
|
| NCBI Gene ID | 4736 |
| GeneCard ID | GC06P038390 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000328, Ag001989, Ag001990
Alignment of all Isoforms |
| Mutation entries | Ag000329, Ag003858
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | RTRGSVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVD
IPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEV
KSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY |