Antigen Record Ag000507

AgACCAg000507
Date01-22-2008
Last updated01-22-2008
Antigen NameIGF2BP3
Common Nameinsulin-like growth factor (IGF)-II mRNA binding protein 3 (IMP-3)
Full NameInsulin-like growth factor 2 mRNA binding protein 3
SynonymDKFZp686F1078; IMP-3; IMP3; KOC1; VICKZ3; hKOC; IGF II mRNA binding protein 3; IGF-II mRNA-binding protein 3; IGF2 mRNA-binding protein 3; Insulin-like growth factor 2 mRNA-binding protein 3; KH domain containing protein overexpressed in cancer; KH domain- containing protein overexpressed in cancer; VICKZ family member 3; insulin-like growth factor 2 mRNA binding protein 3

another display format
  • DKFZp686F1078
  • IMP-3
  • IMP3
  • KOC1
  • VICKZ3
  • hKOC
  • IGF II mRNA binding protein 3
  • IGF-II mRNA-binding protein 3
  • IGF2 mRNA-binding protein 3
  • Insulin-like growth factor 2 mRNA-binding protein 3
  • KH domain containing protein overexpressed in cancer
  • KH domain- containing protein overexpressed in cancer
  • VICKZ family member 3
  • insulin-like growth factor 2 mRNA binding protein 3
UniProt IDO00425
NCBI Gene ID10643
GeneCard IDGC07M023316
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000506,  Ag000508

Alignment of all Isoforms
RNA/protein expression profileRNA and protein Expression profile
T cell epitopeEpitope sequencePositionHLA alleleReference
KTVNELQNL127-135 A*2402  17784873
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMPPPTSGPPSAMTPPYPQFEQSETETVHQFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKV
RMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEV
VVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK