| AgACC | Ag000495 |
| Date | 01-22-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | BTBD2 |
| Common Name | BTB domain containing 2 (BTBD2) |
| Full Name | BTB (POZ) domain containing 2 |
| Synonym | BTB (POZ) domain containing 2; BTB domain containing 2; BTB/POZ domain-containing protein 2; Weakly similar to F38H4.7 [C.elegans]
another display format
- BTB (POZ) domain containing 2
- BTB domain containing 2
- BTB/POZ domain-containing protein 2
- Weakly similar to F38H4.7 [C.elegans]
|
| UniProt ID | Q9BX70
|
| NCBI Gene ID | 55643 |
| GeneCard ID | GC19M001985 |
| Comment | This is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000494
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | MTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSD
RIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLP
NVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT |