| AgACC | Ag000480 |
| Date | 01-22-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TRPM8 |
| Common Name | Prostate-specific protein transient receptor potential-p8 (trp-p8) |
| Full Name | Transient receptor potential cation channel, subfamily M, member 8 |
| Synonym | CMR1; LTRPC6; LTrpC6; MGC2849; TRPP8; Trp-p8; trp-p8; Long transient receptor potential channel 6; Transient receptor potential cation channel subfamily M member 8; Transient receptor potential-p8; cold-menthol receptor type 1; short form of the TRPM8 cationic channel; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential subfamily M member 8
another display format
- CMR1
- LTRPC6
- LTrpC6
- MGC2849
- TRPP8
- Trp-p8
- trp-p8
- Long transient receptor potential channel 6
- Transient receptor potential cation channel subfamily M member 8
- Transient receptor potential-p8
- cold-menthol receptor type 1
- short form of the TRPM8 cationic channel
- transient receptor potential cation channel, subfamily M, member 8
- transient receptor potential subfamily M member 8
|
| UniProt ID | Q7Z2W7
|
| NCBI Gene ID | 79054 |
| GeneCard ID | GC18P000657 |
| Comment | This is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000479, Ag000481, Ag002103
Alignment of all Isoforms |
| Mutation entries | Ag000482
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| GLMKYIGEV | 137-145 | A*0201 |
12858355 |
| Predicted HLA binders | |
| Antigen sequence | MKSFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMK
YIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC |