Antigen Record Ag000480

AgACCAg000480
Date01-22-2008
Last updated14-12-2016
Antigen NameTRPM8
Common NameProstate-specific protein transient receptor potential-p8 (trp-p8)
Full NameTransient receptor potential cation channel, subfamily M, member 8
SynonymCMR1; LTRPC6; LTrpC6; MGC2849; TRPP8; Trp-p8; trp-p8; Long transient receptor potential channel 6; Transient receptor potential cation channel subfamily M member 8; Transient receptor potential-p8; cold-menthol receptor type 1; short form of the TRPM8 cationic channel; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential subfamily M member 8

another display format
  • CMR1
  • LTRPC6
  • LTrpC6
  • MGC2849
  • TRPP8
  • Trp-p8
  • trp-p8
  • Long transient receptor potential channel 6
  • Transient receptor potential cation channel subfamily M member 8
  • Transient receptor potential-p8
  • cold-menthol receptor type 1
  • short form of the TRPM8 cationic channel
  • transient receptor potential cation channel, subfamily M, member 8
  • transient receptor potential subfamily M member 8
UniProt IDQ7Z2W7
NCBI Gene ID79054
GeneCard IDGC18P000657
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000479Ag000481Ag002103

Alignment of all Isoforms
Mutation entriesAg000482

View mutation map
RNA/protein expression profileRNA and protein Expression profile
T cell epitopeEpitope sequencePositionHLA alleleReference
GLMKYIGEV137-145 A*0201  12858355
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMKSFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMK
YIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC