Antigen Record Ag000475

AgACCAg000475
Date01-22-2008
Last updated14-12-2016
Antigen NamePTHLH
Common NameParathyroid hormone-related protein (PTHrP)
Full NameParathyroid hormone-like hormone
Synonym107-139); HHM; MGC14611; PLP; PTH-rP; PTHR; PTHRP; PTHrP; osteostatin; 1-36 PTHrP; 38-94 Osteostatin; PTH-related protein; Parathyroid hormone-related protein precursor; humoral hypercalcemia of malignancy; parathyroid hormone-like hormone; parathyroid hormone-like protein; parathyroid hormone-like related protein; parathyroid hormone-related protein; parathyroid-like protein

another display format
  • 107-139)
  • HHM
  • MGC14611
  • PLP
  • PTH-rP
  • PTHR
  • PTHRP
  • PTHrP
  • osteostatin
  • 1-36 PTHrP
  • 38-94 Osteostatin
  • PTH-related protein
  • Parathyroid hormone-related protein precursor
  • humoral hypercalcemia of malignancy
  • parathyroid hormone-like hormone
  • parathyroid hormone-like protein
  • parathyroid hormone-like related protein
  • parathyroid hormone-related protein
  • parathyroid-like protein
UniProt IDP12272
NCBI Gene ID5744
GeneCard IDGC12M027959
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000474,  Ag000476

Alignment of all Isoforms
Mutation entriesAg004117

View mutation map
RNA/protein expression profileRNA and protein Expression profile
T cell epitopeEpitope sequencePositionHLA alleleReference
FLHHLIAEI59-67 A2  15389794
QLLHDKGKSI42-51 A2  15389794
RAVSEHQLL36-44 A24  15199397
RYLTQETNKV102-111 A24  15199397
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR