Antigen Record Ag000237

AgACCAg000237
Date11-02-2007
Last updated14-12-2016
Antigen NameCDKN2A
Full NameCyclin-dependent kinase inhibitor 2A
SynonymCDK4 inhibitor p16-INK4; isoform 4, Cyclin-dependent kinase 4 inhibitor A; Cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3; Multiple tumor suppressor 1; cell cycle negative regulator beta; cyclin-dependent kinase inhibitor 2A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); cyclin-dependent kinase inhibitor p16; ARF; CDK4I; CDKN2; CDKN2A; CMM2; INK4; INK4a; MLM; MTS1; P16; TP16; p14; p14ARF; p16; p16-INK4; p16-INK4a; p16INK4; p16INK4A; p16INK4a; p19; p19ARF

another display format
  • CDK4 inhibitor p16-INK4
  • isoform 4, Cyclin-dependent kinase 4 inhibitor A
  • Cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3
  • Multiple tumor suppressor 1
  • cell cycle negative regulator beta
  • cyclin-dependent kinase inhibitor 2A
  • cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)
  • cyclin-dependent kinase inhibitor p16
  • ARF
  • CDK4I
  • CDKN2
  • CDKN2A
  • CMM2
  • INK4
  • INK4a
  • MLM
  • MTS1
  • P16
  • TP16
  • p14
  • p14ARF
  • p16
  • p16-INK4
  • p16-INK4a
  • p16INK4
  • p16INK4A
  • p16INK4a
  • p19
  • p19ARF
UniProt IDP42771
NCBI Gene ID1029
GeneCard IDGC09M021957
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000235Ag000236Ag000238Ag001904

Alignment of all Isoforms
Mutation entriesAg000811Ag000812Ag000813Ag000814Ag000815Ag000816Ag000817Ag000818Ag000819Ag000820Ag000821Ag000822Ag000823Ag000824Ag000825Ag000826
... Display all entries
Ag000827Ag000828Ag000829Ag000830Ag000831Ag000832Ag000833Ag000834Ag000835Ag000836Ag000837Ag000838Ag000839Ag000840Ag000841Ag000842Ag000843Ag000844Ag000845Ag000846Ag000847Ag000848Ag000849Ag000850Ag000851Ag000852Ag000853Ag000854Ag000855Ag000856Ag000857Ag000858Ag000859Ag000860Ag000861Ag000862Ag000863Ag000864Ag000865Ag000866Ag000867Ag000868Ag000869Ag000870Ag000871Ag000872Ag000873Ag000874Ag000875Ag000876Ag000877Ag000878Ag000879Ag000880Ag000881Ag000882Ag000883Ag000884Ag000885Ag000886Ag000887Ag000888Ag000889Ag000890Ag000891Ag000892Ag000893Ag000894Ag000895Ag000896Ag000897Ag000898Ag000899Ag000900Ag000901Ag000902Ag000903Ag000904Ag000905Ag000906Ag000907Ag000908Ag000909Ag000910Ag000911Ag000912Ag000913Ag000914Ag000915Ag000916Ag000917Ag000918Ag000919Ag000920Ag000921Ag000922Ag000923Ag000924Ag000925Ag000926Ag000927Ag000928Ag000929Ag000930Ag000931Ag000932Ag000933Ag000934Ag000935Ag000936Ag000937Ag000938Ag000939Ag000940Ag000941Ag000942Ag000943Ag000944Ag000945Ag000946Ag000947Ag000948Ag000949Ag000950Ag000951Ag000952Ag000953Ag000954Ag000955Ag000956Ag000957Ag000958Ag000959Ag000960Ag000961Ag000962Ag000963Ag000964Ag000965Ag000966Ag000967Ag000968Ag000969Ag000970Ag000971Ag000972Ag000973Ag000974Ag000975Ag000976Ag000977Ag000978Ag000979Ag000980Ag000981Ag000982Ag000983Ag000984Ag000985Ag000986Ag000987Ag000988Ag000989Ag000990Ag000991Ag000992Ag000993Ag000994Ag000995Ag000996Ag000997Ag000998Ag000999Ag001000Ag001001Ag001002Ag001003Ag001004Ag001005Ag001006Ag001007Ag001008Ag001009Ag001010Ag001011Ag001012Ag001013Ag001014Ag001015Ag001016Ag001017Ag001018Ag001019Ag001020Ag003733Ag003734Ag003735Ag003736Ag003737Ag003738Ag003739Ag003740Ag003741Ag003742Ag003743Ag003744Ag003745Ag003746Ag003747Ag003748Ag003749Ag003750Ag003751Ag003752Ag003753Ag003754Ag003755Ag003756Ag003757Ag003758Ag003759Ag003760Ag003761


View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVGRRSAAGAGDGGRLWRTKF
AGELESGSASILRKKGRLPGEFSEGVCNHRPPPGDALGAWETKEEE