Antigen Record Ag000200

AgACCAg000200
Date11-02-2007
Last updated14-12-2016
Antigen NameSART3
Full NameSquamous cell carcinoma antigen recognized by T-cells 3
SynonymSimilar to X. LAEVIS NUCLEOLIN; Tat-interacting protein of 110 kDa; squamous cell carcinoma antigen recognised by T cells 3; KIAA0156; MGC138188; RP11-13G14; SART-3; TIP110; Tip110; hSART-3; p110(nrb)

another display format
  • Similar to X. LAEVIS NUCLEOLIN
  • Tat-interacting protein of 110 kDa
  • squamous cell carcinoma antigen recognised by T cells 3
  • KIAA0156
  • MGC138188
  • RP11-13G14
  • SART-3
  • TIP110
  • Tip110
  • hSART-3
  • p110(nrb)
UniProt IDQ15020
NCBI Gene ID9733
GeneCard IDGC12M108522
CommentThis sequence is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000198Ag000199Ag001872

Alignment of all Isoforms
Mutation entriesAg003581Ag003582

View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEY
AMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP