| AgACC | Ag000173 |
| Date | 11-02-2007 |
| Last updated | 20-12-2016 |
| Antigen Name | CAMEL |
| Full Name | CTL-recognized antigen on melanoma |
| UniProt ID | O95146
|
| NCBI Gene ID | 30848 |
| GeneCard ID | GC0XM154651 |
| Comment | This protein is an alternative ORF of CTAG2. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000172
Alignment of all Isoforms |
| Mutation entries | Ag002173
View mutation map |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| LAAQERRVPR | 18-27 | A31 |
9759882 |
| LMAQEALAFL | 2-11 | A*0201 |
11120859 |
| MLMAQEALAFL | 1-11 | A*0201 |
10399963 |
| Predicted HLA binders | |
| Antigen sequence | MLMAQEALAFLMAQGAMLAAQERRVPRAAEVPGAQGQQGPRGREEAPRGVRMAARLQG |