| AgACC | Ag000131 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | FGF5 |
| Common Name | Fibroblast growth factor 5 or FGF5 |
| Full Name | Fibroblast growth factor 5 precursor |
| Synonym | fibroblast growth factor 5; heparin-binding growth factor 5; FGF5; HBGF-5; Smag-82; FGFR5; FGF-5
another display format
- fibroblast growth factor 5
- heparin-binding growth factor 5
- FGF5
- HBGF-5
- Smag-82
- FGFR5
- FGF-5
|
| UniProt ID | P12034
|
| NCBI Gene ID | 2250 |
| GeneCard ID | GC04P080266 |
| Comment | This sequence is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000130, Ag001826
Alignment of all Isoforms |
| Mutation entries | Ag003544
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQ
GSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR |